PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g024390.1
Common NameKNOX1, MTR_2g024390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family TALE
Protein Properties Length: 375aa    MW: 42139.2 Da    PI: 6.6705
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g024390.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-093003361955
                      HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                       +k +yps++++  LA+++gL+++q+ +WF N+R ++
  Medtr2g024390.1 300 HYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 336
                      45679*****************************885 PP

2ELK41.13.8e-14256277122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK qLlrKYsgyLgsLkqEF+
  Medtr2g024390.1 256 ELKGQLLRKYSGYLGSLKQEFM 277
                      9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.3E-17115159IPR005540KNOX1
PfamPF037908.0E-21117155IPR005540KNOX1
SMARTSM012562.1E-24166217IPR005541KNOX2
PfamPF037912.8E-20170216IPR005541KNOX2
PfamPF037896.2E-11256277IPR005539ELK domain
SMARTSM011882.8E-8256277IPR005539ELK domain
PROSITE profilePS5121311.174256276IPR005539ELK domain
PROSITE profilePS5007113.086276339IPR001356Homeobox domain
SuperFamilySSF466891.71E-19278354IPR009057Homeodomain-like
SMARTSM003891.2E-12278343IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.9E-28281341IPR009057Homeodomain-like
CDDcd000861.24E-12288340No hitNo description
PfamPF059206.8E-17296335IPR008422Homeobox KN domain
PROSITE patternPS000270314337IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MEGSSNGSCS YVMGAFGENS GGLCPPMMMM PLVTSSHHNA HHPINSNNNN TNANNTTGLF  60
LPIPNSTNNN NNHYTNCNNN TSSIMLQNNH QNTPGLGYYF MDNINNHGSS SSSSSSVKSK  120
IMAHPHYHRL LEAYINCQKV GAPSEVVARL EEACATAVRM GGDAVGSGCL GEDPALDQFM  180
EAYCEMLIKY EQELSKPLKE AMLFLQRIEV QFKNLTVSSS SDNIACSEGG DRNGSSEEDH  240
VDLYNNMIDP QAEDRELKGQ LLRKYSGYLG SLKQEFMKKR KKGKLPKEAR QQLLEWWSRH  300
YKWPYPSESQ KLALAESTGL DQKQINNWFI NQRKRHWKPS EDMQFVVMDP SHPHYYMDNV  360
LTNSYPMDLS NTML*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1271280LKQEFMKKRK
2277281KKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.1210.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1280560.0EF128056.1 Medicago truncatula class I KNOX homeobox transcription factor (KNOX1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013462900.10.0homeobox knotted-like protein
SwissprotP466081e-171HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA5Y4G60.0A5Y4G6_MEDTR; Class I KNOX homeobox transcription factor
STRINGGLYMA09G01000.21e-169(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-131KNOX/ELK homeobox transcription factor
Publications ? help Back to Top
  1. Di Giacomo E, et al.
    Characterization of KNOX genes in Medicago truncatula.
    Plant Mol. Biol., 2008. 67(1-2): p. 135-50
    [PMID:18274864]
  2. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]